SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021491 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021491
Domain Number 1 Region: 3-163
Classification Level Classification E-value
Superfamily EF-hand 1.82e-45
Family Calmodulin-like 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021491   Gene: ENSBTAG00000016147   Transcript: ENSBTAT00000021491
Sequence length 166
Comment pep:known chromosome:UMD3.1:17:35347484:35351627:1 gene:ENSBTAG00000016147 transcript:ENSBTAT00000021491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRPSSDQWKKNAAKIELNETQKQEIKEAFDLFDVDGSGTIDVKELKIAMRALGFEPKK
EEIKKMIAETDKEGIGTISFEKFFAIMSVKMSEKDEKEEILKAFKLFDDDDTGSISLNNI
KRVAKELGENLTDDELQEMLDEADHDGDGEINKEEFLKMMQKTTLY
Download sequence
Identical sequences Q32LH2
NP_001033128.1.59421 NP_001033128.1.76553 XP_005899794.1.15283 XP_010858576.1.44457 ENSBTAP00000021491 ENSBTAP00000021491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]