SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021537 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021537
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 2.08e-30
Family Calmodulin-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021537   Gene: ENSBTAG00000016179   Transcript: ENSBTAT00000021537
Sequence length 187
Comment pep:known_by_projection chromosome:UMD3.1:7:7873255:7883711:1 gene:ENSBTAG00000016179 transcript:ENSBTAT00000021537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTSCPDVKVPYELIG
SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICAWDLEQTVTKLTRGELSTEEVSLICEKVLDEADGDHDGRLSLEDFQNMILRAPDFL
STFHIRI
Download sequence
Identical sequences E1B8J5
ENSBTAP00000021537 ENSBTAP00000021537 NP_001179141.1.59421 NP_001179141.1.76553 XP_005901527.1.15283 XP_005962951.1.78601 XP_014951257.1.66739 XP_014961840.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]