SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021569 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021569
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-125
Family Transglutaminase core 0.0000000000144
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.59e-41
Family Transglutaminase N-terminal domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 469-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.52e-32
Family Transglutaminase, two C-terminal domains 0.00000193
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-28
Family Transglutaminase, two C-terminal domains 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021569   Gene: ENSBTAG00000016208   Transcript: ENSBTAT00000021569
Sequence length 687
Comment pep:known chromosome:UMD3.1:13:67663138:67697607:-1 gene:ENSBTAG00000016208 transcript:ENSBTAT00000021569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELVLERCDLELEANGRDHHTADLCRERLVVRRGQPFWLTLHFEGRNYEASVDSLTFC
AVTGPDPSEEAGTKALFRLSDATEEGAWAAVAADQRDSTLSLHLSTPANAPVGHYRLSLE
ASTGYQGSSFMLGQFTLLFNSWCPADAVYLDSDEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEEGILDICLMLLDVNPKFLRNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYADGISPMSWIGSVDILRRWKRDGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQDDGSLHKSINHSL
VVGLKISTKCVGRDDREDITHSYKYPEGSPEEREAFTRANHLNKLVNKEETGVAMRIRVG
EGMNRGCDFDVFAHITNSTPEEHTGRLLLCARTVSYNGILGPECGTKDLLSLSLEPYSEK
SIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEISLQNPLTVALSGCTFTVEGAGLIEEQKTVDIPDPVEAGEEVKVRVDLLPLYVG
RHKLVVNFESDRLKAVKGFRNVIVGPS
Download sequence
Identical sequences A0A140T892
ENSBTAP00000021569 ENSBTAP00000021569 XP_019827962.1.53367 9913.ENSBTAP00000021569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]