SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021570 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021570
Domain Number 1 Region: 13-319,423-464
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-74
Family FAD-linked reductases, N-terminal domain 0.000000000189
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.24e-36
Family L-aminoacid/polyamine oxidase 0.000000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021570   Gene: ENSBTAG00000016206   Transcript: ENSBTAT00000021570
Sequence length 527
Comment pep:known chromosome:UMD3.1:X:105380194:105462564:-1 gene:ENSBTAG00000016206 transcript:ENSBTAT00000021570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITVETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLSAKDIWIQEPEAED
VPAVEITPSFWERNLPSVSGLLKIVGFSTSITALWFVMYRFRLLSRS
Download sequence
Identical sequences L8IW67 P21398
9913.ENSBTAP00000021570 ENSBTAP00000021570 ENSBTAP00000021570 NP_851357.2.59421 NP_851357.2.76553 XP_005891579.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]