SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021618 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021618
Domain Number 1 Region: 26-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.47e-140
Family Myeloperoxidase-like 0.0000296
Further Details:      
 
Domain Number 2 Region: 802-938
Classification Level Classification E-value
Superfamily EF-hand 2.03e-29
Family Calmodulin-like 0.0057
Further Details:      
 
Domain Number 3 Region: 1275-1375
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.05e-16
Family Ferredoxin reductase FAD-binding domain-like 0.01
Further Details:      
 
Domain Number 4 Region: 1385-1552
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.00000000000000634
Family Flavohemoglobin, C-terminal domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000021618
Domain Number - Region: 1145-1256
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0458
Family Calcium ATPase, transmembrane domain M 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021618   Gene: ENSBTAG00000016246   Transcript: ENSBTAT00000021618
Sequence length 1553
Comment pep:known chromosome:UMD3.1:10:65492593:65522895:-1 gene:ENSBTAG00000016246 transcript:ENSBTAT00000021618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFHFALVWTLLVGPWMPMGSQNSISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
DGVYQPLGEPHLPNPRALSNTAMRGPAGLASLQNRTVLGVFFGYHVLSDLVSVEKSGCPA
EFLNIHIPPGDPVFDRDHSGDVVLPFQRSRWDPETGQSPSNPRDLTNEVTGWLDGSAIYG
SSHSWSDELRSFSGGQLASGPDPAFPRAAQAPLLMWMPPDPTTGRRGPRGLYAFGAERGN
REPFLQALGLLWFRYHNLWAQKLARRYPLWGDEELFQHARKRVIATYQNIAMYEWLPSFL
RKMPPEYAGYRPFLDPSISPEFLAASEQFFSTMVPPGVYMRNASCHFQGVINRNSSVSRA
LRVCNSYWSREHPNLQRAEDVDALLLGMASQIAEREDHVVVEDVRDFWPGPLKFSRTDHL
ASCLLRGRDLGLPSYTKARATLGLPPVTRWQDINPALSRSDGTVLEATAALYNQDLSRLE
LLPGGLLESHGDPGPLFSTIILDQFVRLRDGDRYWFENSKNGLFSEREIAEIRNTSLRDV
LVAVTKVDSGALQPSVFFWHAGDPCPQPGQLSTKGLPACAPPIMRDYFEGSGFGFGVTIG
TLCCFPLVSLLSAWIVAQLRRRNLKRLQGQDRQSIMCEKLMGGIKAMEWQGRKEPCRPVL
VHLQPGQIHMVDGRLSVLRTVQLRPPQQVNLILSSNHGRRALLLKIPKEYDLVLLFDLEE
ERQVMVESLRGALKESGLNFQEWELREQELMRAAVTREQRSHLLETFFRHLFSQVLDIDQ
ADAGALPLDSSQKVQEALTCELSRAEFAESLGLKPQDMFVQSMFSLADKDGNGYLSFREF
LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLTKTQLAEVV
ESMFRESGFQDKQELTWEDFHFMLRDHDSELRFTQLCVKGVEVPEVIKDLCRRASYISQE
KLCPSPRVSAHRPRKDADIEVELTPRRLQYPNDTDPPQEIRRRFGKKVTSYQPLLFTEAH
REKFQRSRRHQTVQQFKRFVENYRRHIGCLAVFYAIAGGLFLERAYHYAFAAHHKGITDT
TRVGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRLIASTAI
VLTVLHSAGHVVNVYLFSISPLSVLSCLFPGLFHDNGSEFPQKYYWWFFQTVPGLTGVML
LLILAIMYIFASRHFRRCSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPAL
IYVGDKLVSLSRKKVEISVVKAELLPSGVTHLEFQRPQGFEYKSGQWVRIACLALGTTEY
HPFTLTSAPHEETLSLHIRAAGPWTTRLREIYSPPTDDSCAKYPKLYLDGPFGEGHQEWH
KFEVSVLVGGGIGVTPFASILKDLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIRE
VEENDRQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSVTHFGRPPF
EAFFNSLQKVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF
Download sequence
Identical sequences E1BMK1
NP_001192603.1.59421 NP_001192603.1.76553 XP_010807638.1.76553 ENSBTAP00000021618 ENSBTAP00000021618 9913.ENSBTAP00000021618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]