SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021742 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021742
Domain Number 1 Region: 89-268
Classification Level Classification E-value
Superfamily EF-hand 3.13e-51
Family Calmodulin-like 0.000000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021742   Gene: ENSBTAG00000016343   Transcript: ENSBTAT00000021742
Sequence length 270
Comment pep:known_by_projection chromosome:UMD3.1:26:22422214:22440709:-1 gene:ENSBTAG00000016343 transcript:ENSBTAT00000021742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQSRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAA
PASLRPHRPRLLDPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPS
GIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTTDDR
LNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNK
DGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences F1N410
ENSBTAP00000021742 9913.ENSBTAP00000021742 XP_005225652.1.76553 XP_005888139.1.15283 XP_005980775.1.78601 XP_006053200.1.26621 XP_017896810.1.57651 XP_020753476.1.74333 ENSBTAP00000021742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]