SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021805 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021805
Domain Number 1 Region: 602-907
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.95e-115
Family PDEase 0.0000000778
Further Details:      
 
Domain Number 2 Region: 191-390
Classification Level Classification E-value
Superfamily GAF domain-like 1.16e-46
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 374-571
Classification Level Classification E-value
Superfamily GAF domain-like 9.16e-41
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021805   Gene: ENSBTAG00000016396   Transcript: ENSBTAT00000021805
Sequence length 928
Comment pep:known chromosome:UMD3.1:2:18823638:19247733:1 gene:ENSBTAG00000016396 transcript:ENSBTAT00000021805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASRLDFGEVETFLDRHPELLEDYLMRKGKQEMVEKWMQRHGQGQGAVGPRSTPAASTS
GGGGSGSPGPDGSASSQPTPGGGECRGGPMGPSWASGSRGDGSLQRRASQKELRKSFARS
KAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRVNLPQYPPT
AMDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSLFLVEGAAA
GKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIPDAYQDRRF
NDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQMYLPFCGI
AISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLL
EDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSVAELVASTGLPVNI
SDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFE
AFVIFCGLGINNTIMYDQVKKSWAKQSVALDNQVLSYHATCSKAEVDKFKAANIPLVSEL
AIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNW
RHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQL
YGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTE
FFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRER
AELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWE
ELHQKRLLVSAAASAPSANVMETRDDRN
Download sequence
Identical sequences E1BPD8
ENSBTAP00000021805 9913.ENSBTAP00000021805 ENSBTAP00000021805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]