SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021871 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021871
Domain Number 1 Region: 135-176
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000256
Family SAP domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021871   Gene: ENSBTAG00000016450   Transcript: ENSBTAT00000021871
Sequence length 187
Comment pep:known chromosome:UMD3.1:13:29756747:29778409:-1 gene:ENSBTAG00000016450 transcript:ENSBTAT00000021871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCGGAAAMVAFCAGLWVSNPGRAQGQEAGGIPGADCEVCQEFLSRFYNSLIARGVNFSL
DTIEKELINFCLDVKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAAKICEKLKKMD
SQICELKYEKKLDLASVDLSKMRVAELKQILHSWGEECRACAEKTDYVNLIKELAPKYAA
THPQTEL
Download sequence
Identical sequences F1N4N8
NP_001192698.1.59421 NP_001192698.1.76553 XP_019828648.1.53367 ENSBTAP00000021871 ENSBTAP00000021871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]