SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021895 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021895
Domain Number 1 Region: 454-762
Classification Level Classification E-value
Superfamily Folate-binding domain 2.2e-81
Family Aminomethyltransferase folate-binding domain 0.0000749
Further Details:      
 
Domain Number 2 Region: 42-257,362-443
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.99e-54
Family FAD-linked reductases, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 259-361
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.31e-19
Family L-aminoacid/polyamine oxidase 0.06
Further Details:      
 
Domain Number 4 Region: 764-857
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000556
Family Aminomethyltransferase beta-barrel domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021895   Gene: ENSBTAG00000016471   Transcript: ENSBTAT00000021895
Sequence length 878
Comment pep:known_by_projection chromosome:UMD3.1:18:1910952:1951890:-1 gene:ENSBTAG00000016471 transcript:ENSBTAT00000021895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRLLAVVRGPGSCRGWREGSPARGSASATVAPPVALPAQAQVVVCGGGIMGTSVAYHL
SKMGWKDVVLLEQGRLAAGSTRFCAGILSTARHLAIEQKMADYSNKLYHQLEQETGIQTG
YTRTGSIFLAQTQDRLISLKRINSRLNVIGIPCEIISPKKVAELHPLLNVHDLVGAMHVP
EDAVVSSADVALALASAASQSGVQIYDRTSILHVMVKKGQVAGVETDKGQIQCQYFVNCA
GQWAYELGLCSEEPVSIPLHACEHFYLLTRPWETPLPSSTPTVVDADGRIYIRNWQGGIL
SGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPQLETLEIVKLVNCPETF
TPDMRCIMGESPSVRGYFVLVGMNSAGLSFGGGAGKYLAEWMVYGYPSENVWELDLKRFG
ALQSSRTFLRHRVMEVMPLLYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFER
PKYFIPPDKDLLALEQSKTFYKPDWFEIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQA
LEILQYLFSNDLDVPVGHIVHTGMLNERGGYENDCSIARLSKRSFFMISPTDQQVHCWAW
LKKYMPEDSNLILEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGYA
NGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAF
WGQDLNTLTTPLECGGESRVKLDKGVDFIGRDALLQQRQNGVYKRLTMFILDDHDTDLDL
WPWWGEPIYRNGRYVGKTTSSAYGYTLERHVCLGFVHNFSEDTGEEQVVTADFINRGEYE
IDIAGHRFQAKAKLYPVPSLLTHKRRKEDVELSDLHGK
Download sequence
Identical sequences F1N4M3
ENSBTAP00000021895 ENSBTAP00000021895 XP_005218381.1.76553 XP_015331152.1.76553 XP_019834792.1.53367 XP_019834793.1.53367 XP_019834794.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]