SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021909 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021909
Domain Number 1 Region: 154-309
Classification Level Classification E-value
Superfamily EF-hand 4.56e-28
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 2 Region: 44-180
Classification Level Classification E-value
Superfamily EF-hand 3.77e-19
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021909   Gene: ENSBTAG00000016481   Transcript: ENSBTAT00000021909
Sequence length 315
Comment pep:known_by_projection chromosome:UMD3.1:4:93532937:93554971:1 gene:ENSBTAG00000016481 transcript:ENSBTAT00000021909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
FDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDLNQ
DGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
Download sequence
Identical sequences F1N3H1 W5NYK9
ENSBTAP00000021909 9913.ENSBTAP00000021909 ENSBTAP00000021909 ENSOARP00000003257 XP_004008094.1.66739 XP_005905312.1.15283 XP_005905313.1.15283 XP_005981472.1.78601 XP_011986881.1.54773 XP_019814604.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]