SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021967 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021967
Domain Number 1 Region: 14-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-85
Family Eukaryotic proteases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021967   Gene: ENSBTAG00000020582   Transcript: ENSBTAT00000021967
Sequence length 317
Comment pep:known_by_projection chromosome:UMD3.1:25:2179213:2183525:1 gene:ENSBTAG00000020582 transcript:ENSBTAT00000021967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVPATPPPLGAPCLGVLASLLILAAPATMDAIKTAGPPACGKRLQLNRIVGGEDSSDAE
WPWVVSIRKNGTHHCAGSLLTSRWVLTAAHCFKDNLDKPTQFSVLLGAWQLGNPGPRSQE
VGIAWAQPHPVYSWKEGSRADIALVRLERAIQFSERVLPICLPDSTVQLSPDTNCWIAGW
GSVHDGVPLSHPQTLQKLKVPIIDSATCSRLYWRGAGQGAITEDMLCAGYLEGERDACLG
DSGGPLMCQVEGTWLLAGVISWGEGCAQRNRPGVYISLAAHRSWVQRIVQGVQLRGRSQR
GGPTGRRGRALGARRPR
Download sequence
Identical sequences E1BNJ9
9913.ENSBTAP00000021967 ENSBTAP00000021967 ENSBTAP00000021967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]