SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022068 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022068
Domain Number 1 Region: 687-738
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000000000183
Family Eferin C-derminal domain-like 0.0000875
Further Details:      
 
Domain Number 2 Region: 203-274
Classification Level Classification E-value
Superfamily EF-hand 0.00000000125
Family Calmodulin-like 0.05
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022068
Domain Number - Region: 634-684
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000575
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022068   Gene: ENSBTAG00000016591   Transcript: ENSBTAT00000022068
Sequence length 738
Comment pep:known_by_projection chromosome:UMD3.1:25:404964:464143:1 gene:ENSBTAG00000016591 transcript:ENSBTAT00000022068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRARPPAPPRGCPRPPPRPERLCLPPAAPLASGTRAAAGGAPMKMEPGRPASPAGGPGPD
PEPGGPGAPSAPARSPGLGPQDPAAGVDAGRSPGWERRPQRAGRDPDPDPDPDSDPDLAL
PELGPFFSWTMEPEGDGPGHSASIRAQDFSRSHHLRGEVDFFPSFAAPEVGDSALELGPG
DPDGPSDFSQTHPLTSEPAGCPEDSPRLRAVFDALDGDGDGFVRIEDFVQFATVYGAEQV
TDLTRYLDPSGLGVISFEDFYRGIEAIRNGDPDSPLCSVTPAPDEELPACPEEFDDFVTF
EANEVTDSAYMGSESTYSECETFTDEDTGTLVPPECLDAAEEPGHGALLLLPGRSHLQGQ
SVVAVIGGEEHFEDYGEGSEAELSPETLCGGDRGCRDPAFLTPSPAKRLSSKKVARHLQQ
SGALTMEALQDSPPGPVEGMDEDIADKVVFLEKRVSELEKDTAANGEQHSRLRQENLQLV
HRANALEEQLKEQELRACEMVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSEL
RSCTPCLKANIERLEEEKQKLLDEIEELSVRLSDEQENRRKLGDRLSHERHQFQRDKEAT
QELIEDLRKQLEHLQLFKLEAEQRRGRSSSAGLQEYHSRTRESELEQEVRRLKQDNRSLK
EQNDELNGQIINLSIQGARSLFSTAFSESLAAEISSVSRDELMDAIQKQEEINFRLQDYI
DRIIVAIMETNPSILEVK
Download sequence
Identical sequences F1MMB2
ENSBTAP00000022068 ENSBTAP00000022068 9913.ENSBTAP00000022068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]