SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022103 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022103
Domain Number 1 Region: 393-493
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00064
Further Details:      
 
Domain Number 2 Region: 107-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000279
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 
Domain Number 3 Region: 203-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000114
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 297-386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000775
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 26-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000209
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022103   Gene: ENSBTAG00000017204   Transcript: ENSBTAT00000022103
Sequence length 502
Comment pep:novel chromosome:UMD3.1:3:12475181:12484872:-1 gene:ENSBTAG00000017204 transcript:ENSBTAT00000022103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLCSFIKVLAPRGKKKDWLSIDMPYYAYEGDQVVVRCSGRDNNKIKRLTFYKDGAWLPA
YYNTYIISNARPSDSGSYYCKAKRKVFLFIDDTEQTRSAWLTVRELFPAPQLTTRPLQPT
EGASVTLSCGTQLPADRSETQLRYSFYRGGYTLRSDWDSPEFWISEIWKEDSGYYWCEAR
TVSHSVSKQSQQSYIQVQRIPVSGVLLETQPQRDQVVKGETLVLVCSVAKGTGKTRFSWH
REGTRESLGEKSQRSQRAELEMPVIRESHAGRYYCTADNGYGLIQSEAVNVTVRIPVSRP
VLTFSVPGAQALTGDVVELRCEDKRASPPILYRFYHENVPLGHTSAPFGGGASFNLAVTA
RHSGTYACEANNGLGAQRSNVAVLHVAEFPPKICLMNGPHHCEGRVEVEKEGRWGTVCDD
GWDMKDVAVVCRELGCGAAKHTPAGMLYLPVAEEDQPVFIQVALCNGTEETLAECEQVET
FDCGHDEDAGAVCEVTVAPAAF
Download sequence
Identical sequences F1MLF3
9913.ENSBTAP00000022103 ENSBTAP00000022103 ENSBTAP00000022103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]