SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022185 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022185
Domain Number 1 Region: 3-230
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.26e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0059
Further Details:      
 
Domain Number 2 Region: 313-487
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000112
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022185   Gene: ENSBTAG00000016685   Transcript: ENSBTAT00000022185
Sequence length 553
Comment pep:known chromosome:UMD3.1:16:39722590:39759444:1 gene:ENSBTAG00000016685 transcript:ENSBTAT00000022185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAVIGAGVSGLSSIKCCLDEHLEPICFERSNDIGGLWKFTETSKDGMTRVYKSLVT
NVCKEMSCYSDFPFQEDYPNFMNHEKFWNYLQEFAEHFDLLKYIQFKTTVCSITKRPDFS
ETGQWDVVTETEGRQDRAVFDAVMVCTGHFLNPRLPLESFPGIHKFKGQILHSQEYKIPA
GFQDKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVINRSSDGGYPLNMMVTRRHH
NFIAQVLPSCILKWIQERHLNKRFDHANYGLNITKGVLRKKPKKIVNDELPTCILCGTVT
IKTSVKEFTETSAVFEDGTVEENIDVVIFTTGYTYSFPFFEEPLKTLCTKKIFLYKLVFP
SNLEKTTLAMIGFISLTGSILAGTELQARWATRIFKGLCKIPPSQKLMAEAMKKEQLIER
GLMKDPGADKIDYISYMDDLASFIGVKPNIPLLFIKDPRLAWEVFFGPCTPYQYRLMGPG
KWDGARNAILTQWDRTLKPLKTRTIPGSFKPASMSHYLKAWGAPILLASFLLIYKSSIFL
KLVPEKLQDRLSP
Download sequence
Identical sequences G5E5J8
ENSBTAP00000022185 ENSBTAP00000022185 NP_001179159.1.59421 NP_001179159.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]