SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022407 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022407
Domain Number 1 Region: 206-289
Classification Level Classification E-value
Superfamily Globin-like 0.0000945
Family Globins 0.036
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022407
Domain Number - Region: 49-81
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000922
Family Calpain large subunit, catalytic domain (domain II) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022407   Gene: ENSBTAG00000016844   Transcript: ENSBTAT00000022407
Sequence length 731
Comment pep:known_by_projection chromosome:UMD3.1:9:85126832:85215490:1 gene:ENSBTAG00000016844 transcript:ENSBTAT00000022407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCTDELADYGVNDTVHPAEGISLEKDLVSQTTATQEKSQEELTTINNGVSKEIWLDFEDF
CVCFQTIYIFHKPSSYCLNFQKSEFKFSDERVSYHLFVDSLKPIELLICLSALVRWGESG
ALTKNSPPIEPGLLTVETISWKSLRPRDLVVTIHTYATKATVVRLPVGRHMLLFTAYSPV
GHSIHICSMVTFVIGDEDVVLPNFEPESYRFTEQALTILKAVGHVIANFKDKAKLSAALK
DLQTAHYPIPLQDKELTAQHFRVFHISLWRLMKKAQITKPPPNTKFAFRAVVLHLDLLDS
SLEEASLAEWVDAKYNVPTSDKEYSPEEVAAAIKIQAMWKGTYVRLLMKARTPVLDTKEN
ASVADSLQKVWAMLEQNMEQYAVSLLRLMFKSKCKSMESYPCYQDEETKIAFADYTVTYT
DQPPNTWFIVFRETFLVPQDMILVPKVYTSLPVCMLHIVNNDTMEQVPKVFQKVVPYLYT
KNKKGYTFVAEAYTGDMYVSSSRWKLRLIGSYHPLPCLSRDPPCNTFAIKEIRDYYIPND
KKIIFRYSVKVALPHPVTIQVRTSKPDVFIKLQILENEEVIVSSTGKGQAIIPAINFLGN
EKALSSQSHGEKHEELITLGSPDSHTISEGQKSSGTSKATRKGKEKSSEKEKTAKEKQAP
RFEPQMCAAHPQQDDPNKPYWILRLPRLVSIISASSLGKRLMLSACLCLKAKSKQGKKGA
CCGRSGKQARA
Download sequence
Identical sequences F1MP20
9913.ENSBTAP00000022407 ENSBTAP00000022407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]