SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022588 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022588
Domain Number 1 Region: 318-608
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.23e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000272
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.54e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 3 Region: 35-114
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000262
Family CRAL/TRIO N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022588   Gene: ENSBTAG00000016984   Transcript: ENSBTAT00000022588
Sequence length 625
Comment pep:known_by_projection chromosome:UMD3.1:21:33697444:33766711:1 gene:ENSBTAG00000016984 transcript:ENSBTAT00000022588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRRGHAEAEAHRTGLPALPGDFCPPGGGSGGGMEPATAPQPDMAPELTPEEEQATKQFLE
EINKWTVQYNVSPLSWNVAVKFLMARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLR
SEILSGKFTILNVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNG
LVFIYDMCGSNYTNFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKD
KVRERIQILKTSEVTQHLPRECLPENLGGYVKIDLATWNFQFLSQMNGHPDPFDEIILFS
LPPALDWDSVHVPDPQAMTIQELMDYVSTRQKRGIYEEYEDIRRENPVGTFHCSMSPGNL
EKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWL
MVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMTHYKKTTLE
IHNIEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRAVRNQQRLAVSSMGARAKGQCPE
PPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCY
KAILEFAEREGMVPPSHNLLAMEGQ
Download sequence
Identical sequences F1N6W1
ENSBTAP00000022588 ENSBTAP00000022588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]