SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022612 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022612
Domain Number 1 Region: 432-486
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000121
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 2 Region: 49-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000046
Family Ubiquitin-related 0.0093
Further Details:      
 
Domain Number 3 Region: 353-418
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000667
Family IBR domain 0.038
Further Details:      
 
Domain Number 4 Region: 281-324
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000126
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 5 Region: 192-220
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000589
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022612
Domain Number - Region: 243-293
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0262
Family Rad50 coiled-coil Zn hook 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022612   Gene: ENSBTAG00000017002   Transcript: ENSBTAT00000022612
Sequence length 510
Comment pep:known chromosome:UMD3.1:13:61147247:61164402:-1 gene:ENSBTAG00000017002 transcript:ENSBTAT00000022612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKIKKAEEVAQRLTRAVAGGDEQVAMQCAIWLAEQRVPLNVQLKPEVSPTQDIRLWVS
VEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPTLQQWVIGQRLARDQETLHSHGVR
RDGDSAYLYLLSACNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLDPVPPKPGAAQE
PGRGQPDAVPEPPPVGWTCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARL
AGEEEALRQYQQRKQQQQEGNYRKHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLREC
LHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIRALLSPEEYQRFLDLGISI
AENRSAFSYHCKTPDCKGWCFFEDDVNEFPCPVCFHVNCLLCKAVHEQMNCKEYQDDLAL
RAQNDMAARQTTEMLRTMLQQGEAMHCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPR
WGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Download sequence
Identical sequences Q1JPC8
NP_001068629.1.59421 NP_001068629.1.76553 XP_019827749.1.53367 ENSBTAP00000022612 ENSBTAP00000022612 9913.ENSBTAP00000022612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]