SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022630 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022630
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 1.9e-19
Family Calbindin D9K 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022630   Gene: ENSBTAG00000017020   Transcript: ENSBTAT00000022630
Sequence length 79
Comment pep:known chromosome:UMD3.1:X:134101039:134104560:-1 gene:ENSBTAG00000017020 transcript:ENSBTAT00000022630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKN
GDGEVSFEEFQVLVKKISQ
Download sequence
Identical sequences P02633 W5PU09
ENSOARP00000013940 9913.ENSBTAP00000022630 ENSBTAP00000022630 NP_776682.1.59421 NP_776682.1.76553 XP_004021986.1.66739 XP_005701114.1.57651 XP_005888771.1.15283 XP_005982038.1.78601 XP_006040081.1.26621 XP_006078337.1.26621 XP_010828931.1.44457 XP_012026342.1.54773 ENSBTAP00000022630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]