SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022720 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022720
Domain Number 1 Region: 413-526
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-31
Family SH2 domain 0.000000657
Further Details:      
 
Domain Number 2 Region: 102-191
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.39e-28
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 218-348
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000101
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022720   Gene: ENSBTAG00000017086   Transcript: ENSBTAT00000022720
Sequence length 529
Comment pep:known chromosome:UMD3.1:4:5104899:5244348:1 gene:ENSBTAG00000017086 transcript:ENSBTAT00000022720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASLESLCAASETVPLLHNGQHSRGPVPRARVLQPQAAPRQRVQRSQPVSILAVRRLQE
EDLHLRTSSLPAIPNPFPELCGPGSPPALTPGSLPPGPAAAKQDVKVFSEDGTSKVVEIL
ADMTARDLCQLLVYRSHCVDDNSWALVEHHPHLGLERCLEDHELVVQVESTMASESKFLF
RKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSHTQLLQNFLNSSSCPEIQGFLHVKELGRK
SWKKLYVCLRRSGLYCSTKGASKEPRHLQLLADLEDSSIFSLIAGRKQYSAPTDYGFCIK
PNRVRNEAKELRLLCAEDEQSRTCWMTACRLLKYGMLLYQNYRIPQQRKAMLSHFSTPVR
SVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSALST
VIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQIL
PCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCRLKHHCIRVAL
Download sequence
Identical sequences F1MGY2
NP_001179515.1.59421 NP_001179515.1.76553 ENSBTAP00000022720 ENSBTAP00000022720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]