SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022878 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022878
Domain Number 1 Region: 5-210
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-48
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022878   Gene: ENSBTAG00000017214   Transcript: ENSBTAT00000022878
Sequence length 212
Comment pep:novel chromosome:UMD3.1:2:5512932:5514784:1 gene:ENSBTAG00000017214 transcript:ENSBTAT00000022878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVFLNSEKDTCLGTLIHKQWVLTAAHCFLPFLEMDIAISDERFQKRMEGLRPMLIIPHPS
FKQDSAEHDIVLIKLTRPLKLNDQVKLAALPSPTTNRMDNCAVFGWGWSWQNSEPKPDVK
INQTVSCFPNEHCEASPIGKMPVKITENMFCAGLSLESKHTCKEVLAAPILCQNQLQGIL
SWSEGCVLRGDVGYYTKVSRYTDWIHRVISAY
Download sequence
Identical sequences F1MGE8
ENSBTAP00000022878 ENSBTAP00000022878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]