SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023091 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023091
Domain Number 1 Region: 419-529
Classification Level Classification E-value
Superfamily SH2 domain 8.35e-32
Family SH2 domain 0.000000772
Further Details:      
 
Domain Number 2 Region: 97-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-29
Family Ras-binding domain, RBD 0.00000913
Further Details:      
 
Domain Number 3 Region: 230-343
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000162
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023091   Gene: ENSBTAG00000017366   Transcript: ENSBTAT00000023091
Sequence length 532
Comment pep:known chromosome:UMD3.1:19:40753903:40762633:1 gene:ENSBTAG00000017366 transcript:ENSBTAT00000023091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGLSPLHLSSSPEDLYLASGTPPGTPPPLDAPLSGEVKRSQPLPIPTSRKLLREEELQ
STSLPSIPNPFPELCSPSSQSPILGGSSSARGLLPRDTSCPHVIKVYSEDGTCRSVEVAT
GATARYVCEMLVQRSHALSDENWGLVECHPYLALERALEDHESVAEVQAAWPIGGDSRIV
FRKNFAKYELFKSTPHSLFPEKMVSSCLDAHTGMSHEDVIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCIKPNKLRNGHKGLRLFCTEDERSRSCWLAAFRLFKFGVQLYKNYQQTLCRHMCPPCGG
SPPSRSVSDDTLVAMDFSGHAGRVIENPREALSAALEEAQAWRKKTNHRLSLPTPSSGTS
LSAAIHRTQPWFHGRISREESQRLIRQQGLVDGLFLVRESQRNPQGFVLSLCHVQKVKHY
LILPSEEEGRLYFSMDDGLTRFTDLLQLVEFHQLNRGILPCLLRYCCTRVAL
Download sequence
Identical sequences Q1RMW5
ENSBTAP00000023091 9913.ENSBTAP00000023091 NP_001039479.1.59421 NP_001039479.1.76553 XP_005220751.1.76553 XP_005220752.1.76553 XP_005220753.1.76553 XP_005220754.1.76553 XP_015314313.1.76553 ENSBTAP00000023091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]