SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023239 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023239
Domain Number 1 Region: 257-593
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.18e-68
Family PDEase 0.0000117
Further Details:      
 
Domain Number 2 Region: 6-43,70-218
Classification Level Classification E-value
Superfamily GAF domain-like 1.1e-31
Family GAF domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023239   Gene: ENSBTAG00000017480   Transcript: ENSBTAT00000023239
Sequence length 616
Comment pep:known_by_projection chromosome:UMD3.1:6:108838343:108849344:1 gene:ENSBTAG00000017480 transcript:ENSBTAT00000023239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGE
AQAYSGPRTPDGREILFYKVIDYILHGKEDIKVIPSPPADHWALASGLPTYVAESGFICN
IMNAPADEMFNFQEGPLDDSGWIVKNVLSMPIVNKKEIVGVATFYNRKDGKPFDEQDEVL
MESLTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDREEIQLILPTRERLGKEP
ADCEEDELGKILKEVLPGPAKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQ
EEVWGQAMSAQNGQCGLAKHTRPHPFHPSSTPRRAVGRAGTWAFHTAVSWKCVAGTGHCG
AWTPCLTSRNLCDRSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVI
HLMDIAIIATDLALYFKKRTMFQKIVDESKNYEDRKSWVEYLSLETTRKEIVMAMMMTAC
DLSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDF
VCTFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEDQKKETTAKKVGTE
ICNGGPAPRSSTCRIL
Download sequence
Identical sequences F1N0U0
ENSBTAP00000023239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]