SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023383 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023383
Domain Number 1 Region: 249-414,820-999
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.22e-125
Family Mammalian PLC 0.00000689
Further Details:      
 
Domain Number 2 Region: 572-685
Classification Level Classification E-value
Superfamily SH2 domain 6.87e-31
Family SH2 domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 473-589
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-27
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1018-1139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.2e-25
Family PLC-like (P variant) 0.0022
Further Details:      
 
Domain Number 5 Region: 718-779
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-19
Family SH3-domain 0.0000267
Further Details:      
 
Domain Number 6 Region: 2-69
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000302
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 7 Region: 82-246
Classification Level Classification E-value
Superfamily EF-hand 0.000000265
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023383   Gene: ENSBTAG00000017584   Transcript: ENSBTAT00000023383
Sequence length 1219
Comment pep:known chromosome:UMD3.1:13:70510824:70524389:1 gene:ENSBTAG00000017584 transcript:ENSBTAT00000023383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNM
WIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMR
FLRERLTDLEQRTSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSLP
EFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSIWNS
QLDEVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGP
DGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKV
LGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKN
GILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASGSTELHSNEKWFH
GKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHS
RQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHAS
LTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFD
SLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTF
KCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSP
AALEPEREHLDENSPLGDLLRGVLDVPACQIAVRPEGKNNRLFVFSISMASVAHWSLDVA
ADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGT
ERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICG
SQLVALNFQTPDKPMQMNQALFLAGGHCGYVLQPSVMRDEAFDPFDKSSLRGLEPCAICI
EVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVWPAKPFHFQISNP
EFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEGLELASLLVKIDVF
PAKQENGDLSPFGGASLRERSCDASGPLFHGRAREGSFEARYQQPFEDFRISQEHLADHF
DGRDRRTPRRTRVNGDNRL
Download sequence
Identical sequences F1MYF9
ENSBTAP00000023383 ENSBTAP00000023383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]