SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023397 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023397
Domain Number 1 Region: 30-119
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-16
Family V set domains (antibody variable domain-like) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023397   Gene: ENSBTAG00000017593   Transcript: ENSBTAT00000023397
Sequence length 232
Comment pep:known chromosome:UMD3.1:23:15148077:15163188:-1 gene:ENSBTAG00000017593 transcript:ENSBTAT00000023397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKARLWGLLWMLFIEEIQAAAEVFEEKCTLAEGQTLKVSCPTNTNIYSNSQKAWQRLKD
NGEVQTLAITEGSSQVRVGKYFLEDIPSEGMLQIQMANLQVEDSGLYRCVILGPSDPIIL
FHPVRLVVTKNSLGTPASDEYPCQVSVQNPTPLPVTTKLRPRPRPRPKPVTQPIPTSADR
LSSPGFTVTPTNVTHVNRAPGISIIIPAACGLLSKTLVFIGLFAVTHRSFAS
Download sequence
Identical sequences F1MYF4
9913.ENSBTAP00000023397 ENSBTAP00000023397 ENSBTAP00000023397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]