SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023441 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023441
Domain Number 1 Region: 202-565
Classification Level Classification E-value
Superfamily SIS domain 5.29e-104
Family double-SIS domain 0.000000414
Further Details:      
 
Domain Number 2 Region: 2-96,133-177
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.09e-26
Family Class II glutamine amidotransferases 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023441   Gene: ENSBTAG00000017626   Transcript: ENSBTAT00000023441
Sequence length 565
Comment pep:known chromosome:UMD3.1:11:67684390:67728959:-1 gene:ENSBTAG00000017626 transcript:ENSBTAT00000023441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVER
VIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSC
NLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKR
TAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGL
KDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDV
CFFISQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTK
AYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYH
QKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRD
HTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLL
AFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F1MZY2
9913.ENSBTAP00000023441 ENSBTAP00000023441 ENSBTAP00000023441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]