SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023514 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023514
Domain Number 1 Region: 395-606
Classification Level Classification E-value
Superfamily VPS9 domain 7.06e-35
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 66-190
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000525
Family SH2 domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023514   Gene: ENSBTAG00000017681   Transcript: ENSBTAT00000023514
Sequence length 790
Comment pep:known chromosome:UMD3.1:29:45029460:45034780:-1 gene:ENSBTAG00000017681 transcript:ENSBTAT00000023514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPREPGTGPLGTPYPASFASGHLEREKPAQDPRYDVPGAGGVQAGGSQRPGRTVSLRE
RLLLTRPVWLQLRANEAAALHVLRTEPPGTFLVRKSNSRQCQALCVRLPEASGPSFVSSH
CIQETAEGVSLEGSELVFLDLVQLICAYCHTRDILLLPLQLPRAIRQAATHKELEAISHL
GMEFWSSSLNTKAQPGPSEGPPLPRLKPRPPQELDQGTGAALCFFNPLFPGDLGHTKREK
FKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGTVPNQTERLPPRQLLRRESSVGYRVPGG
AGPSLPPLPSLQEVDCASPSSSEEEGGVPGSQGSPATSPHLGYRRRRRPLLRSMSAAFCS
LLAPERQVGRAAAALTQDRHTAVGQLVQDLLTQVRASPEPRELQAVREALSRARAMLSAE
LSPEKLLSPDRLEQVLEKSLHRSVLKPLRPILVARLRHRLSANSSLGRLAEGLRLARARG
ASAFGSHLSLPSPVEMEQVRQKLLQLLRAYSPSAQVKRLLQACKLLYTALRTQAGEGAGA
DEFLPLLSLVLAHCDLPELLLEAEYMSELLEPALLTGEGGYYLTSLSASLALLSGLTEAH
TLPLSPSQELQRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLN
KLCATKFRVTHPDTFGLFLYKGQDYQRLPPGALAHRLPTAGYLVYRRAEQPETPGASPGA
ATGEGSGGPEAGDREEDKEGRGTGETKAKTSPRDGRGESETVAEGAEDQARGDPTQPRGP
ETEESQAAEE
Download sequence
Identical sequences E1BDA1
ENSBTAP00000023514 ENSBTAP00000023514 9913.ENSBTAP00000023514 NP_001179146.1.59421 NP_001179146.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]