SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023673 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023673
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000581
Family Parvalbumin 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023673   Gene: ENSBTAG00000017805   Transcript: ENSBTAT00000023673
Sequence length 399
Comment pep:known_by_projection chromosome:UMD3.1:29:50710076:50739409:-1 gene:ENSBTAG00000017805 transcript:ENSBTAT00000023673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAMASAPGAGEAQEEEGWEHGRTSGPLATMLEQAQELFLLCDKEAKGFITRHDLQGLQSD
LPLTPEQLEAVFESLDQAHTGFLTAREFCLGLGKFVGAEATAGALPSRAPEETFESGWLD
VQGAGGSVEEDEELLSSALEQLGVARVLGEQTDSQRLWHRRMTSQRASQMPQLEEDVLMR
ASACEEAARERDGLEHALRRRESEHQREVRCLYEEMEQQLREQRQRLRGQGLPQEERRGR
LELELQSREQELERAGLRQRELEQQLQARTSEQLEAQAQNAQLWLANEALRTQLEGVQEQ
LRRLEGDAQGRREQAQRDVVAVSRNMQKEKLSLLRQLELLRELNTRLRDERDVCEAQRLG
SSRRKALSSAPLLGAPCCCCCSSWARPPRRGSGHLPSAR
Download sequence
Identical sequences G3X7C2
ENSBTAP00000023673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]