SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023873 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023873
Domain Number 1 Region: 17-91
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000014
Family Calmodulin-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023873   Gene: ENSBTAG00000017955   Transcript: ENSBTAT00000023873
Sequence length 91
Comment pep:novel chromosome:UMD3.1:11:2079469:2096936:1 gene:ENSBTAG00000017955 transcript:ENSBTAT00000023873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSSDSELELSAVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIY
SQFFPQGDATTYAHFLFNAFDADGNGAIRFE
Download sequence
Identical sequences F1MVQ3
ENSBTAP00000023873 ENSBTAP00000023873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]