SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023920 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023920
Domain Number 1 Region: 235-502
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-84
Family Protein kinases, catalytic subunit 0.000000000122
Further Details:      
 
Domain Number 2 Region: 126-266
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-37
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 66-151
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023920   Gene: ENSBTAG00000017976   Transcript: ENSBTAT00000023920
Sequence length 1136
Comment pep:known chromosome:UMD3.1:11:101118800:101150880:1 gene:ENSBTAG00000017976 transcript:ENSBTAT00000023920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLECVCGEVGVGGRKGRVLTSLSFSSLSLPEALQRPVASDFEPQGLSEAARWNSKENLLA
GPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYI
TPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRI
NTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWE
MERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHP
NLVQLLGVCTREPPFYIITEFMTYGNLLDYLRDCNRQEVNAVVLLYMATQISSAMEYLEK
KNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKF
SIKSDIWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACW
QWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGMRGVAGTLLQAPELPTKTRTSR
RAAEHKDSPDMPETPHSKGPGETDPVDHEPAVSPLLPRKERGPPDGSLNEDERLLPKDKK
TNLFSALIKKKKKTAPTPPKRSSSFREMDGPPERKAASEEEGREISNGALAPAPPDAVES
AKSPKPSGGAGVPNGAFRESGGAGFRSPHLWKKSSTLTSSRLAAGEEESGSGASKRFLRS
CSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRASENRSDQMT
RGTVTPPPRLVKKTEEAADEVFKDAAEASPGSSPPSLTPKPIRRQGAAAPPSSPPHKEEA
GRPSAAGMPAEPAPPTSRAGLGASGGPSKAAATAAEEPRGRRHKPTSESPGRDRGKLSKL
KPAPPPPPPTSAGKAGKSSQSPSQEAAGEAGAGAKVKPAALAADAVNSDTAKSGQLGEGA
KKPVLPSMPKPPASTKPAGTPTSPAPTPATLPSAPSALAGDQPSSTAFIPLISTRVSLRK
TRQPPERIASGAITKGMVLDGTEALCLAISKNSEQMASHSAVLEAGKNLYTFCVSYVDSI
QQMRNKFAFREAINKLENNLRELQICPATAGGGPAATQDFSKLLSSVKEISDIVQR
Download sequence
Identical sequences F1MXG8
ENSBTAP00000023920 ENSBTAP00000023920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]