SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024046 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024046
Domain Number 1 Region: 1325-1638
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.66e-112
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000183
Further Details:      
 
Domain Number 2 Region: 1602-1890
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.16e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000637
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 5.74e-47
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 606-812
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-41
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 5 Region: 812-999
Classification Level Classification E-value
Superfamily Fibronectin type III 8.51e-40
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 6 Region: 501-610
Classification Level Classification E-value
Superfamily Fibronectin type III 4.29e-20
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 7 Region: 32-126
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-18
Family I set domains 0.0031
Further Details:      
 
Domain Number 8 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 10 Region: 1008-1097
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000487
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024046   Gene: ENSBTAG00000000253   Transcript: ENSBTAT00000024046
Sequence length 1898
Comment pep:known chromosome:UMD3.1:3:102998562:103067133:-1 gene:ENSBTAG00000000253 transcript:ENSBTAT00000024046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPLGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPAAS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVSYYGIQYRPAGAE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVDSDTRIQLSWLLPPQERI
VKYELVYWAAEDEGQQHKVTFDPTSSYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEAR
TAQSTPSAPPQKVTCVSVGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GIGREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVRVSWKLPVPSKQHGQIRGYQVTYVRLENGEPRGAPIIQDVMLAEAQETTISGLTP
ETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMVSTTAMNTALLQWHPPKELPGE
LLGYRLQYRRADEARPSTIDFGKDDQHFTVTGLHKGATYIFRLTAKNRAGLGEEFEKEIT
TPEDVPSGFPQNLRVIGLTTSTTELIWDPPVLAERNGRITNYTVVYRDINSQQELQNVTA
DTHLTLSGLKPDTTYDIKVRARTSKGAGPLSPSIQSRTMPVEQVFAKNFRVEAAMKTSVL
LSWEVPDSYKSAVPFRILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQH
LVSIRTAPDLLPHKPLPASAYIEDGRFTLTMPRVQEPALVRWFYIMVVPIDRMGGSMLAP
QWSTPEELELDELLEAIEQGGGERLRRRRQTERLKPYVAAQVDVLPETFTLGDKKNYQGF
YNRPLSPDLSYQCFVLASLKEPVDQKRYACSPYSDEIVVQVTPAQQQEEPELLWVTGPVL
AVILIVLIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNYQTPGMRDH
PPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDH
SRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMM
TRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALYKSGSSEKRELRQF
QFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMK
HEKTVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAAMCGHTEVPARNLYAHIQKLGQ
VPPGESVTAMELEFKLLANSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGV
EGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTRLREMGREKC
HQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP
KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQ
TVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Download sequence
Identical sequences A7MBJ4
ENSBTAP00000024046 NP_001094549.1.59421 NP_001094549.1.76553 ENSBTAP00000024046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]