SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024307 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024307
Domain Number 1 Region: 274-500
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.34e-71
Family CAT-like 0.00003
Further Details:      
 
Domain Number 2 Region: 56-150
Classification Level Classification E-value
Superfamily Single hybrid motif 2.62e-26
Family Biotinyl/lipoyl-carrier proteins and domains 0.0002
Further Details:      
 
Domain Number 3 Region: 180-220
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000275
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024307   Gene: ENSBTAG00000018261   Transcript: ENSBTAT00000024307
Sequence length 501
Comment pep:known chromosome:UMD3.1:15:66231837:66307403:1 gene:ENSBTAG00000018261 transcript:ENSBTAT00000024307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASWRLGCDPRLLRCLLGFGSRRSPELVKGAARWSVGRGASWRWFHSTQWLRADPIKIL
MPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVAEGSK
NIRLGSLIGLLVEEGEDWKHVEIPKDTGPPPPAAKPSVPPPSAEPQIATPVKKEHPPGKV
QFRLSPAARNILEKHALDANQGTATGPRGIFTKEDALKLVQLKQTGKITEPRPTAALPTT
PAAPLPPQAAATASYPRPMIPPVSTPGQPNVEGTFTEIPASNIRRVIAKRLTESKSTIPH
AYATTDCDLGAVLTARQNLVRDDIKVSVNDFIIKAAAVTLKQMPNVNASWDGEGAKQLPS
IDISVAVATDRGLITPVIKDAAAKGLQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL
GMFGIDEFTAVINPPQACILAVGRFRPVLKLTQDEEGNAQLQQRQLITVTMSSDSRVVDD
ELATRFLESFKANLENPLRLA
Download sequence
Identical sequences P22439
ENSBTAP00000024307 9913.ENSBTAP00000024307 NP_001069219.1.59421 NP_001069219.1.76553 ENSBTAP00000024307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]