SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024444 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024444
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily EF-hand 9.1e-36
Family Calmodulin-like 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024444   Gene: ENSBTAG00000018369   Transcript: ENSBTAT00000024444
Sequence length 166
Comment pep:known_by_projection chromosome:UMD3.1:17:56953813:56961603:-1 gene:ENSBTAG00000018369 transcript:ENSBTAT00000024444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMLKEAPGPINFTVFLQMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIK
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Download sequence
Identical sequences F1ME15
ENSBTAP00000024444 9913.ENSBTAP00000024444 ENSBTAP00000024444 XP_005217810.1.76553 XP_005897466.1.15283 XP_010839683.1.44457 XP_010839684.1.44457 XP_014334206.1.15283 XP_019833437.1.53367 XP_019833438.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]