SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024518 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024518
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-22
Family SH3-domain 0.0000788
Further Details:      
 
Domain Number 3 Region: 111-168
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-17
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024518   Gene: ENSBTAG00000018427   Transcript: ENSBTAT00000024518
Sequence length 377
Comment pep:known chromosome:UMD3.1:1:133319427:133395740:-1 gene:ENSBTAG00000018427 transcript:ENSBTAT00000024518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELNIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDIMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
Download sequence
Identical sequences Q1LZB2
ENSBTAP00000024518 NP_001069540.1.59421 NP_001069540.1.76553 XP_005201936.1.76553 XP_005201937.1.76553 XP_005201938.1.76553 XP_005889953.1.15283 XP_006070686.1.26621 XP_006070687.1.26621 XP_006070688.1.26621 XP_010856549.1.44457 XP_010856550.1.44457 XP_010856552.1.44457 XP_019817601.1.53367 XP_019817606.1.53367 XP_019817610.1.53367 ENSBTAP00000024518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]