SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024541 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024541
Domain Number 1 Region: 26-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.39e-39
Family Eukaryotic proteases 0.0000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024541   Gene: ENSBTAG00000018442   Transcript: ENSBTAT00000024541
Sequence length 235
Comment pep:known chromosome:UMD3.1:4:105909792:105915720:-1 gene:ENSBTAG00000018442 transcript:ENSBTAT00000024541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFTFCLTVLAGTFFSAHSSVQKDDPSPYLVYLKSHFNPCVGVLIKSNWVLAPAHCYLPN
LKVMLGNLRIRIRDGTEQTINPIQIIRYWNHSHTAPQDDLMLIRLAKPAILNEKVQPIAL
ATSTVKPGTICMLSGLDWSQNNNGRHPDLRQNLEAPVMSDTACQETEQGKSHRNSICVKF
LKVFSRIFGELAVATVICKNKLQGIEVGHFMGGDVGIYTNVQKYVSWIESTTKDK
Download sequence
Identical sequences Q32KU2
ENSBTAP00000024541 NP_001035659.1.59421 NP_001035659.1.76553 XP_010853272.1.44457 ENSBTAP00000024541 9913.ENSBTAP00000024541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]