SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024550 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024550
Domain Number 1 Region: 37-199
Classification Level Classification E-value
Superfamily EF-hand 1.03e-42
Family Penta-EF-hand proteins 0.000000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024550   Gene: ENSBTAG00000018446   Transcript: ENSBTAT00000024550
Sequence length 201
Comment pep:known_by_projection chromosome:UMD3.1:2:34173878:34193022:-1 gene:ENSBTAG00000018446 transcript:ENSBTAT00000024550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGYGGGFGNFGNPLGQPGYPGHPAYPGSISTGDPMWKCFLAIAGQDGEVDAEELQKC
LTQSGISGTYSPFSLETCRIMIAMLDRDYSGKMGFNEFKELWAALNSWKQNFITVDKDGS
GSVEHHELNQAIAAMGYRLSPQTVTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRRRD
HLQQGVVSFVYDDFLQGTMAV
Download sequence
Identical sequences F1N7I6
XP_006074056.1.26621 XP_014334160.1.15283 XP_015317767.1.59421 XP_015331044.1.76553 ENSBTAP00000024550 ENSBTAP00000024550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]