SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024586 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024586
Domain Number 1 Region: 380-478
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024586   Gene: ENSBTAG00000018473   Transcript: ENSBTAT00000024586
Sequence length 478
Comment pep:known_by_projection chromosome:UMD3.1:2:71099131:71134074:1 gene:ENSBTAG00000018473 transcript:ENSBTAT00000024586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENEEILKEKELLASTEDGTALDQTMLSRMETFEVNDPKPKRRNGMNCIMVLVILYLVLL
TAGAGLLVIQVLNLQERLRVLEMPYNNETQAQLTQVVTKQETLQQRMDNFIQIPGIFQSK
GAQGGPRLPHLPGPLTGYILNSFSFPGPPGPRGPPGIKGEAGEQGLGITGGKGRPGSAGN
SGKKKVGDPSGARGGPGSGGETAGSEDKGADKFLGFSGRKGDMGMKGDMGPPGARGDKGD
SGKPGFPGVAGIPGIKGDQGPPGMKGLPGFPGAVGSPGAKGDTGSIGPTGPIGPPGLPGT
PGVEGVKGSKGDTGLQGQKGTKGESGFPGLSGVKGEKGSPGLGGLKGAPGPTGQKGEPGS
RGATGPQGAKGEKGQKGDSSLSVRIIGSRNRGRAEVFYNGAWGTICDDSWDGSDATVFCR
MLGYSSGSPVYNVGAGSGNIWLDDVACSGSEWTLWDCNKSSWGSHNCNHNEDAGVNCS
Download sequence
Identical sequences F1N7K7
ENSBTAP00000024586 ENSBTAP00000024586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]