SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024649 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024649
Domain Number 1 Region: 24-178
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.21e-29
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 
Domain Number 2 Region: 206-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.22e-25
Family GAS2 domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000024649
Domain Number - Region: 420-440
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0997
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024649   Gene: ENSBTAG00000018519   Transcript: ENSBTAT00000024649
Sequence length 875
Comment pep:known chromosome:UMD3.1:19:14939572:14946571:1 gene:ENSBTAG00000018519 transcript:ENSBTAT00000024649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQPRASRRRPGTPGPRVSSIQPFKSSEQYLEAMKEDLAEWLRDLYGVDISAANFLEVLE
TGLVLCQHANAITEAALAFLAETPDQAQRLPLPRAGVSYNEAAQPRTFQARDNISNFIHW
CRKEMGIQEVLMFETEDLVLRKNVKNVVLCLLELGRRAWRFGVAAPTLVRLEEEIEEELW
LERALPPPKPPPPAPPERRPCHSRDLDQLVQSLVSHCTCPIQFSMVKVSEGKYRVGESNT
LIFIRILRNHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHKTGSFLQPPAHPVQHEVRVQD
GPSQPQPTMTISRSQSPLPAVDWKTYTSSGRKLRPPAVSSPRPQCEQRARPGVHRETAPL
LRCQEKSLAPSRRQLPAGDNLPRPQSSPTPRDQDPPCTSLGKREERHPPEPPRGRTPTSS
VHERTDSRGTHARTPTPQRVRAPEATAKGTPARGLSPLPRSPSPAKPVGPRQPPWGEVEG
ASSQLREPAPVCSPSPVKGSTKIPVQLPPACPPTPGRGFAGTVSGGPSTELKRGPLPLRA
TSDLSGSRHEHCSVEEGQEDLKLGVQVTAEAGGPWGLGPQHREGRCTPLPSGRTKEQGIH
HGLEEELPTNMKLLGMAGARPQGTGSVVIPRSGVYVPSLGGWWPDPGGLYDKVIQELIQD
PPPLLKVDLGAWKAAPPGSPTPAVTACPGSLKGKLRAQESGLRTVANPSAKGISTKAQGG
QDCSAPTVSASPESLTLSPSDPSSERAKACPTKGKRTLRKPQRIPSIYKLKLRPRIRPRR
DHRPEKRPSRIPKPLTCLPLGPVRAPLKGRLVRAALGSKGGEAALVDGASAGEEEDREER
KEPAASLESGSPPSEGQGPWQLDPVPLSPEEESWV
Download sequence
Identical sequences E1BHS6
ENSBTAP00000024649 ENSBTAP00000024649 NP_001192571.1.59421 NP_001192571.1.76553 9913.ENSBTAP00000024649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]