SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024677 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024677
Domain Number 1 Region: 25-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.89e-84
Family Eukaryotic proteases 0.0000000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024677   Gene: ENSBTAG00000018539   Transcript: ENSBTAT00000024677
Sequence length 261
Comment pep:known chromosome:UMD3.1:18:57338709:57343795:-1 gene:ENSBTAG00000018539 transcript:ENSBTAT00000024677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFPVLCLALSLAGTGAVFPIQSRIVGGQECEKHSQPWQVAIYHFSTFQCGGVLVAPQWV
LTAAHCKSDNYQVWLGRHNLFEDEDTAQFAGVSEDFPNPGFNLSLLENHTRHPGEDYSHD
LMLLRLQEPVQLTQNVQVLGLPTKEPQLGTTCYASGWGSVKPDEFSYPDDLQCVDLTLLP
NEKCATAHPQEVTEWMLCAGHLEGGKDTCVGDSGGPLICEGMLQGITSWGHIPCGTPNKP
SVYTKVILYLDWINKTMTDNP
Download sequence
Identical sequences L8IG15 Q6H320
9913.ENSBTAP00000024677 ENSBTAP00000024677 ENSBTAP00000024677 NP_001008416.1.59421 NP_001008416.1.76553 XP_005898493.1.15283 XP_019834007.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]