SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024680 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024680
Domain Number 1 Region: 6-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.33e-82
Family Eukaryotic proteases 0.00000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024680   Gene: ENSBTAG00000018545   Transcript: ENSBTAT00000024680
Sequence length 257
Comment pep:known_by_projection chromosome:UMD3.1:18:57345387:57350243:-1 gene:ENSBTAG00000018545 transcript:ENSBTAT00000024680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLLTFSFLLASAVAQDDSDKVRRDEECVPHSQPWQVALFEHGRFNCGASLISPQWVLS
AAHCQTRFLRVRLGEHNLRKRDGPEQLRTVSRIIPHPRYKALNHRHDLMLLRLTRPVRVT
AEVRPIPLPARCPQAGEACVVSGWGLVANKEPGATGSPESQVRLPDRLHCANISIISTAS
CNKDYAGRLMDTMVCAGVEGGGINSCEGDSGGPLVCGGVLQGIVSWGDVPCDTTTKPGVY
TKVCSYLEWIKETMKRS
Download sequence
Identical sequences E1BH96
ENSBTAP00000024680 XP_005219198.1.76553 ENSBTAP00000024680 9913.ENSBTAP00000024680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]