SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024724 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024724
Domain Number 1 Region: 304-406
Classification Level Classification E-value
Superfamily SRCR-like 1.23e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 43-148
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 415-529
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 
Domain Number 4 Region: 185-283
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024724   Gene: ENSBTAG00000018578   Transcript: ENSBTAT00000024724
Sequence length 752
Comment pep:known_by_projection chromosome:UMD3.1:11:10071901:10089833:1 gene:ENSBTAG00000018578 transcript:ENSBTAT00000024724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVSVWQWSLWGLLLCLLCSSCLGSPTPSTAPEKRAGSQGLRFRLAGFPRKPSEGRVEI
QRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTERS
VTECASRGWGNSDCTHDEDAGVICKDERLPGFSDSNVIEVEHHLQVEEVRLRPAVGRGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVICGMLGFPSEKRVNVGFYRLLAQRQQHS
FGLHGVACVGTEAHLSLCSLEFYRANDTTRCPGGAPAVVSCVPSPLYAASSGQKKQQSKP
QGEARVRLKGGAHPGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGSAREALSGAR
MGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGVETKIRLSG
GRSRHEGRVEVQIGGPGSFRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSGN
VTDVVMSGVRCTGAELSLDQCAHHGTHVTCKRTGSRFTAGVICSETASDLLLHSALVQET
AYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSW
VWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQG
ITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHR
IWVHNCHIGDAFSEEANRRFERYPGQTSNQII
Download sequence
Identical sequences E1BFC8
ENSBTAP00000024724 ENSBTAP00000024724 9913.ENSBTAP00000024724 NP_001179898.1.59421 NP_001179898.1.76553 XP_015328863.1.76553 XP_015328864.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]