SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024756 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024756
Domain Number 1 Region: 21-144
Classification Level Classification E-value
Superfamily Lysozyme-like 1.88e-38
Family C-type lysozyme 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024756   Gene: ENSBTAG00000018601   Transcript: ENSBTAT00000024756
Sequence length 145
Comment pep:known_by_projection chromosome:UMD3.1:22:15245986:15250843:-1 gene:ENSBTAG00000018601 transcript:ENSBTAT00000024756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVLSLIGYLVVPSDTAVLGRCVVAKKLHEGGLSDFEGYSLENWVCLAYFESKFNPM
AVYENSRSDFIGYGLFQIRNHDWCDHGRNRCHMSCSALLNPDLKKTIECAKTIVKGKRGM
GAWPSWTINCQHSDTLARWLDGCKL
Download sequence
Identical sequences G3X7E0
ENSBTAP00000024756 ENSBTAP00000024756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]