SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024966 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024966
Domain Number 1 Region: 10-134
Classification Level Classification E-value
Superfamily Nudix 1.62e-18
Family MutT-like 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024966   Gene: ENSBTAG00000018749   Transcript: ENSBTAT00000024966
Sequence length 201
Comment pep:known chromosome:UMD3.1:1:140044682:140046219:-1 gene:ENSBTAG00000018749 transcript:ENSBTAT00000024966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGGFVD
LRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQLTAV
EMGAPRARDHGLEVGPAQDPTPPPPAPEGLSQLYPRVVGVWVINYSQPGLPAKILLSLLF
TGLCIVFLKLSHPNHSSATTL
Download sequence
Identical sequences Q1JPK7
ENSBTAP00000024966 ENSBTAP00000024966 NP_001069028.1.59421 NP_001069028.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]