SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025085 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025085
Domain Number 1 Region: 626-902
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000075
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-35
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-33
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 4 Region: 507-596
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-19
Family First domain of FERM 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025085   Gene: ENSBTAG00000018841   Transcript: ENSBTAT00000025085
Sequence length 912
Comment pep:known_by_projection chromosome:UMD3.1:8:100604292:100681999:-1 gene:ENSBTAG00000018841 transcript:ENSBTAT00000025085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSVRFLDGLVQTFKVNKQDTGQVLLDMAYN
YLGVTEKEYFGLQHGDDSLDSPRWLEASKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYDSSVHLPGYLSDSQFIPDQ
NEDFLAKVESLHEQHSGLKQSEAESCFINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWSLGSRNPKKSVNNQYCKKVIGGMVWNPAMQRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNRSPHRESISENSPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQQFLED
FHRVTKGGSAEDSSQYYCDKNDGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRIN
PESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVHS
FADIKSEDELNQLFPEAIFPVCPETGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGLA
ITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAAHLMNKYIAAQGPL
PHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEHGSFHIRCQSEDCTI
AYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDGEPVLVH
CSAGIGRTGVLVTMETAMCMIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRV
YEEGLVQMLDPS
Download sequence
Identical sequences E1BIH4
ENSBTAP00000025085 ENSBTAP00000025085 9913.ENSBTAP00000025085 NP_001192616.1.59421 NP_001192616.1.76553 XP_019822257.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]