SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025116 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025116
Domain Number 1 Region: 61-279
Classification Level Classification E-value
Superfamily L domain-like 4.82e-40
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 650-764
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025116   Gene: ENSBTAG00000032839   Transcript: ENSBTAT00000025116
Sequence length 801
Comment pep:known_by_projection chromosome:UMD3.1:1:70845570:70947214:-1 gene:ENSBTAG00000032839 transcript:ENSBTAT00000025116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGLVAVAAAAEYSCPGASGGNLSAVNCGPNSGAGPGPGPGSWSRSLDRALEEAAVTG
VLSLSGRKLREFPRGAANHDLTDTTRADLSRNRLSEIPIEACHFVSLENLNLYQNCIRYV
PEAILNLQALTFLNISRNQLSTLPVHLCELPLKVLIASNNKLVSLPEEIGHLRHLTELDV
SCNEIQTIPSQIGNLEALRDLNVRRNHLVRLPEELAELPLIRLDFSCNKITTIPVCYRNL
RHLQMITLDNNPLQSPPAQICIKGKIHIFKYLNMQACKIAPDLPDYDRRPMGFGSCHEEL
YSGRPYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEITKEQRLRRENQYQENHSS
LVVTNGGVEHELDQIDYIDSCTAEEDEDEVRPHKGLDSDSLSSQFMAYIEQRRISHEGSP
IKPIPMREFQKTEDMRRYSHQNRIRVPAEPSSLLSVSPSHNQFSQTDLELHRRREQLVER
TRREAQLAALQYEEEKIRTKQIQRDAVLDFVKQKASQSPQKQHTPLVGECPFPSRRSQHT
DDSALLVSLSGVNQVGYAAPLPPASAFRPLQNDDRSNAVSNSPTTETAHHSPAYSFPAAI
QRNQPQRPESFLFRGAVRTETNKGHASPLLSSSVPTTDLKDPVTRQNSRQREEELELIDQ
LRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRN
VENFLEACRKIGVPQDNLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVSLSIQLLGF
VAFYCTLMLTLCMLYYWIFPL
Download sequence
Identical sequences E1BGP1
ENSBTAP00000025116 ENSBTAP00000025116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]