SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025402 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025402
Domain Number 1 Region: 310-660
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.62e-130
Family Mammalian PLC 0.000000000014
Further Details:      
 
Domain Number 2 Region: 862-921,961-1137
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 3.4e-68
Family C-terminal domain of PLC-beta 0.00000045
Further Details:      
 
Domain Number 3 Region: 142-306
Classification Level Classification E-value
Superfamily EF-hand 1.31e-46
Family EF-hand modules in multidomain proteins 0.0000000471
Further Details:      
 
Domain Number 4 Region: 12-140
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-41
Family Pleckstrin-homology domain (PH domain) 0.000000316
Further Details:      
 
Domain Number 5 Region: 680-784
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.7e-17
Family PLC-like (P variant) 0.000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025402   Gene: ENSBTAG00000019079   Transcript: ENSBTAT00000025402
Sequence length 1171
Comment pep:known_by_projection chromosome:UMD3.1:10:36024408:36044688:-1 gene:ENSBTAG00000019079 transcript:ENSBTAT00000025402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNPVLLPPTVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMELLD
ITSIRDTRFGKFAKMPKSQKLREVFNMNIRDNFLLKTLTVVSGPDMVDLTFHNFVSYKDN
VGKDWAEDVLALAKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFQMFPADRKRVE
AALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHSKAKPYMTKEHLA
KFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPENSV
LAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDCWK
GKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKMAE
YCRTMFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGSASPSKELDGEAE
GSSPPNAPVGEDTVWAGEEGAELEEEEVEEEEEESGNLDEEEIKKMQSDEGTAGLEVTAY
KEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKSSVQFVDYNKRQMSRI
YPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMRR
SDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRPKRRYRTKLSPSTNSINPVWKEE
PFVFEKILMPELASLRVAVMEEGNKFLGHRIIPISALNSGYHHLCLHNESNMPLTMPALF
VFLEMKDYVPDTWADLTVALANPIKFFSAHDKKAVKLKEAMGGQSESPFPLGNHPASQIN
GASAPTSNGSAAAGAKREEATKETAEPQTASLEELRELKGVVKLQRRQEKELRELGRRGV
RRWEELLQRGAAQLAGLGPPGAGGSGGCRGRKLGPGKGSRKKRTLPGEDTAGAASAEGPE
GEDVRLRELRDRLELELLQLGEEQCECVMKLKEQHAAQQMTKMMELAREKQAAERKTLKE
TLEIDTKEMKKKLEAKRLERIQAMMKVTTDKMAQERLKREINNSHIQEVVQVIKQMTENL
ERHQEKLEEKQAACLEQIQEMEKQFQQEAMAEYEAKMKGLEMEVKESVRTCLRACFPSEE
EDKPERPCVVSRELCEQDTLTEQAETQESHL
Download sequence
Identical sequences E1B7M6
ENSBTAP00000025402 ENSBTAP00000025402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]