SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025455 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025455
Domain Number 1 Region: 913-1041
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000608
Family GAF domain 0.021
Further Details:      
 
Domain Number 2 Region: 748-794
Classification Level Classification E-value
Superfamily EF-hand 0.0000426
Family Calbindin D9K 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025455   Gene: ENSBTAG00000019122   Transcript: ENSBTAT00000025455
Sequence length 1385
Comment pep:known_by_projection chromosome:UMD3.1:19:21725905:21790297:1 gene:ENSBTAG00000019122 transcript:ENSBTAT00000025455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMQVEKKKLLADVDIPTKFDPINHLGEYLMRNNPNYIKDSGLSGYQRVMREISEDLKIY
VPNTTYNRVSKIKENIKQKREQKEYINDIKAKVANARKQALQEQFNEWILDPKGMIPMVV
LISLHIAGFKSETFEKLLKHLCHCAAEFREVIKTDMRRQMFADLFLHCDRGKVGFLDRQR
TLALLETFYDQSSKVLRGTLRNPRQWPFVEFGEIDLPEFWGDMDNQKHIYEDFDNVLLEM
NTLPSEKHFSKTQSKLLASPEDQHEHYRESTLPQSPPEQQRGATVEQGPNGISTREQEQP
EESTGEQELNEESVSKEGTYTGSTPEQRSSRELITEQRPHHEPITEQGVPQGTHIESTAE
QGLSEESITTEGQHEGSTTGQGSHGKSTEEQGSRRESQSDQGQPRETMAEQEAHRESQSD
QGPHGGSTAEPQSSRETILEEQQDTDLTSQSRKGSLTGESKTSRESISFEHTEIPPQEGR
TQAHAYEELLFVSPELQAKTGVSIPEDHLSGKRFLKSAEKSSFRKSLYTRSPFVRKHPGF
QIFILQKTFLGNCLCIFEKKILKFYSPKDFTLSLTNLKSFIFSALYVFLPRTGLLISGSP
YIVGTQPKKLDLLEPAKKEVQKDKSCEPKSQKIEGKSWTGELLTCNWNMKYAKHEDEEQA
HLIYDNSRFTDLHSIIRNIQSYKEIKGRSTFNGVSVNLLQFVQLLETFVGEDSPLSVSEA
LTSFFRKGFVETKEEKMSGLEKARQNASRIRRELLLKALFQKWDCDGSGFLDLKEIDELL
YTYKEGMEKESMKKAKLHVQFPKLHPGHEVRLSSKQFQKYIELVVSELRGNEEEVLESVV
EFLMNSLERSHVESLRNCARQKWLHQIQRAAETSGVSLEPVYTETFKALTQDAEAHGNKK
ISAHISLLEENLLLPDRGNVLLRNVACTLDDAPFVLKRVLYRDMKGISFTVVDEGKPIHV
PQVQHHGNIYFWNHSRKKSDHNGSFLALPLQDAYMRIFGVLAVDTLRDPQKINIFLPHEI
RFYQGVANVFSTAYHYVHSREHILHIVITGIGWLYNITPSITAISTYFVEPNSEDSDYVL
RNMMVTGQQGLTEIHKNPSVIFRKTCIFRDFLFKCTDSSGVVLASVCGENHIVVPLRERT
GEALGVLDVNIGKSKMLLYREFKDLQKMLKVIQLACSEILGEFSGEIKKNYILEIESVGE
VQRAGILFFRVMLQELQECLSLLTSSDFVSLLLHDYDPLAEVKAPPDSQSQDLKANIKLV
QDILKGIIVFFHPELKSSSDLESWDHCKLYVNQQLVENICDFDPTAMELKVNLRLIAEYF
ENHSRIEVWKFGNSAIEYLYHWAHICLALIKLNKKISGAIPPPLPSKTDSCVYAKMPGGS
LPVKV
Download sequence
Identical sequences E1B7P6
ENSBTAP00000025455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]