SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025499 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025499
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily EF-hand 1.1e-22
Family Parvalbumin 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025499   Gene: ENSBTAG00000019159   Transcript: ENSBTAT00000025499
Sequence length 110
Comment pep:known chromosome:UMD3.1:5:75550904:75568048:-1 gene:ENSBTAG00000019159 transcript:ENSBTAT00000025499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTDLLHAEDIKKAVGAFTAVDSFDHKKFFQMVGLKKKSPEDVKKVFHILDKDKSGFIE
EEELGFILKGFSPDARDLSVKETKTLLAAGDKDGDGKIGADEFSTLVAES
Download sequence
Identical sequences L8J4R7 Q0VCG3
ENSBTAP00000025499 9913.ENSBTAP00000025499 NP_001069582.1.59421 NP_001069582.1.76553 XP_005887521.1.15283 XP_010803641.1.76553 XP_019815673.1.53367 ENSBTAP00000025499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]