SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025587 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025587
Domain Number 1 Region: 267-378
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-32
Family Pleckstrin-homology domain (PH domain) 0.0000589
Further Details:      
 
Domain Number 2 Region: 523-625
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-25
Family SH2 domain 0.0000119
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.28e-22
Family Adapter protein APS, dimerisation domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025587   Gene: ENSBTAG00000019219   Transcript: ENSBTAT00000025587
Sequence length 756
Comment pep:known chromosome:UMD3.1:25:26208972:26214950:-1 gene:ENSBTAG00000019219 transcript:ENSBTAT00000025587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAPSPEDGASPSPPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPLLAPLSPGVEVPPHDLSLESCRAGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS
PAGPLETASGPPALGGNSNSNSSGGAGTVSRGLVSDGTSPGDRWTHRFERLRLSRGGGAL
KDGAGVVQREELLSFMGAEEAAPDPAGVGRGGGAAGPTSGGGGQPQWQKCRLLLRSEGEG
GGSRLEFFVPPKASRPRLSIPCSTITDVRTTTALEMPDRENTFVVKVEGPSEYILETADA
LHVKAWVSDIQECLSPGPYPATSPRPMTLPLAPGTSFLTRENTDSLEPPCLNHLESLPSQ
GLLLGPSESSDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEG
PPAGTVHPLAAPYPPLDTPETATGSLLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLV
LAGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDML
EHFRMHPIPLESGGSSDVVLVSYVVSSQRQQEPSTSHDPPQPPEPPSWTDPPHPGAEEAS
GAPEVAAAAAAAAKERQEKEKAGSGGIQEELVPVVELVPVVELEEAVAPGTEAQGGAGSA
GAPGVTLMVQLQQLPLGGDGEEGGHPRAINNQYSFV
Download sequence
Identical sequences F1MJV1
NP_001192458.1.59421 NP_001192458.1.76553 XP_005224920.1.76553 XP_005224921.1.76553 ENSBTAP00000025587 ENSBTAP00000025587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]