SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025661 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025661
Domain Number 1 Region: 345-508
Classification Level Classification E-value
Superfamily EF-hand 6.19e-31
Family Calmodulin-like 0.0045
Further Details:      
 
Domain Number 2 Region: 103-317
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.000000000000196
Family Glycerol-3-phosphate (1)-acyltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025661   Gene: ENSBTAG00000019272   Transcript: ENSBTAT00000025661
Sequence length 544
Comment pep:known chromosome:UMD3.1:18:23861829:23927174:1 gene:ENSBTAG00000019272 transcript:ENSBTAT00000025661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRCADARAVAATVPGADVGNAGLRPPMVPRQASFFPPPVLNPFVQQTRLGVARRIQIFF
LGIILLPIRALLVAIILLLSWSLAAISTACCPEKLTHPITGWKRKITHPVLKFLGHAMFF
SMGFVVTVKGKIATPLEAPIFVVAPHSTFFDGIACVAAGLPSIVSRNENVQVPLVGRILR
ALQPVLVSRVDPDSRKNTINEIIRRATSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPILLRYPNKLDTVTWTWQGYTFIQLCVLTWCQPFTRVEVEFMPVQVPSDEERCDPV
LFASTIRNVMAEALKIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGI
RKHLDEYAAIASSSKGGRIGIEEFAEYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL
AVLCNPANTEEIIQVAFKLFDVDEDGFITEEEFSTILQASLGVPDLDVSGLFKEIAQGDS
VSYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQATPSVVSNKVSPESHEESTSD
KKDD
Download sequence
Identical sequences E1B770
NP_001192726.1.59421 NP_001192726.1.76553 XP_019835561.1.53367 ENSBTAP00000025661 ENSBTAP00000025661 9913.ENSBTAP00000025661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]