SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025686 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025686
Domain Number 1 Region: 426-537
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-33
Family SH2 domain 0.00000474
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.15e-31
Family Ras-binding domain, RBD 0.00032
Further Details:      
 
Domain Number 3 Region: 229-343
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000329
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025686   Gene: ENSBTAG00000019291   Transcript: ENSBTAT00000025686
Sequence length 540
Comment pep:known_by_projection chromosome:UMD3.1:2:31783357:31912200:1 gene:ENSBTAG00000019291 transcript:ENSBTAT00000025686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLQDGQSAAGRAAARDSPLAAQVCGAAQGRGDARDLAPAPWLHARALLPPPDATRGC
AADRRKKKDLDVLEMPSIPNPFPELCCSPFTSVLSAGLFPKANSRKKQVIKVYSEDETSR
ALEVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHVGLERTIEDHELVIEVLSNWGME
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFLLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGY
SSQSISPMRSISENSLVAMDFSGQKTRVIENPTEALSVAVEEGLAWRKKGCLRLGSHGSP
TASSQSSATSMAIHRSQPWFHHKISREEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
Download sequence
Identical sequences F1MBA2
ENSBTAP00000025686 NP_001011681.2.59421 NP_001011681.2.76553 ENSBTAP00000025686 9913.ENSBTAP00000025686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]